For Research Use Only · Discreet Worldwide Delivery · Assisted Payment · Free Shipping Starts at $210

Healing & Recovery

Thymosin Beta-4

per mg

Buy 3, get 25% off on this product — discount applies automatically in your cart.

A 43-amino-acid actin-binding peptide studied for tissue repair, angiogenesis and cell migration. The full-length peptide of which TB-500 is a fragment. For research use only.

Tested

HPLC & MS

Discreet

Tracked ship

Payment

Arranged by support

Description

Thymosin Beta-4 (TB-4) is a naturally occurring 43-amino-acid actin-binding peptide. It is the full-length peptide of which TB-500 is a synthetic fragment. In research settings it is studied for its roles in cell migration, actin regulation, angiogenesis, tissue remodeling, and wound-repair processes in experimental models.

For Research Use Only. Not for human consumption.

Highlights

  • Actin Regulation Research
  • Cell Migration Studies
  • Angiogenesis Research
  • Tissue Remodeling Studies

Storage & handling

Storage: Store lyophilized at -20°C, protected from light. Stable at ambient temperature for short-term shipping.
Reconstitution (lab use): Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution.

Quality & Verification

Purity
≥99%
Tested by
HPLC, MS
Verification
Independent 3rd-party
Request batch COA

Certificate of Analysis available on request

How we test & certify →

Technical data sheet

CAS number
77591-33-4
Molecular formula
C212H350N56O78S
Molecular weight
4963.44 g/mol
Synonyms
Tβ4
Appearance
Lyophilized white powder
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight
≈4963 g/mol
Length
43 amino acids
Form
Lyophilized Powder
Purity
≥99%
Storage
-20°C
Research Use Only
Not for human consumption
CAT / SKU
RBL-TB4
Category
Healing & Recovery

Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

For laboratory and research use only. Not for human or veterinary use, diagnosis, or treatment.

Research FAQ

Thymosin Beta-4 — frequently asked questions

A 43-amino-acid actin-binding peptide studied for tissue repair, angiogenesis and cell migration. The full-length peptide of which TB-500 is a fragment. For research use only. In laboratory settings, research interest commonly focuses on areas such as actin regulation research, cell migration studies, angiogenesis research and tissue remodeling studies.
No. Thymosin Beta-4 is supplied exclusively as a research compound for in-vitro and non-human laboratory study. We do not provide health, dosing, or treatment guidance, and it must be handled by trained personnel following appropriate safety practices. All products are supplied strictly for laboratory and research use only and are not for human consumption.
Tested batches of Thymosin Beta-4 are independently analysed to a target purity of ≥99% by HPLC, MS. The exact figure for each batch is reported on its Certificate of Analysis.
Thymosin Beta-4 has a cas number of 77591-33-4, a molecular formula of c212h350n56o78s and a molecular weight of 4963.44 g/mol. Full technical details are listed in the technical data sheet on this page.
Thymosin Beta-4 should be stored as follows: Store lyophilized at -20°C, protected from light. Stable at ambient temperature for short-term shipping. Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution.
Yes. Tested batches of Thymosin Beta-4 are supplied with documentation of independent third-party purity and identity analysis, so researchers can verify exactly what they receive. The COA is available on this page or on request.
Thymosin Beta-4 is packaged discreetly and shipped worldwide with tracked delivery, typically dispatched within 24 hours of confirmed payment. Checkout is secure cryptocurrency only (BTC, ETH, LTC, USDT).
Thymosin Beta-4 is supplied as lyophilized white powder, sealed in a vial for laboratory research. Orders are packaged discreetly and shipped worldwide with tracking, typically dispatched within 24 hours of confirmed payment.
In the laboratory, Thymosin Beta-4 is reconstituted by dissolving the lyophilized powder in a suitable solvent such as bacteriostatic or sterile water. Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution. Our reconstitution calculator (under Research Tools) can help determine the concentration of the prepared solution. This is laboratory guidance only, not dosing advice.
Yes. Thymosin Beta-4 is also referred to as Tβ4. These names all refer to the same research compound.
The amino-acid sequence of Thymosin Beta-4 is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. The full technical data sheet, including molecular formula and weight, is shown on this product page.
Research compounds such as Thymosin Beta-4 can generally be purchased for laboratory research, but legal status varies by country and by specific compound. Buyers are responsible for knowing and complying with the laws and import regulations in their own jurisdiction. It is supplied for research use only and is not for human consumption.
Yes. We can accommodate larger research orders of Thymosin Beta-4. Contact our research-support team to discuss bulk quantities, current availability and pricing.

Research tool

Reconstitution calculator

Estimate the concentration of Thymosin Beta-4 once reconstituted, and the volume containing a target quantity. A laboratory measurement aid — research use only.

Reconstitution calculator

Solution concentration mg/mL ( mcg/mL)
Volume for target mL ( units)

The target volume exceeds the solvent added — increase the solvent volume or lower the target quantity.

For laboratory measurement and research use only. This tool reports the concentration of a reconstituted solution; it is not dosing guidance and the products are not for human or veterinary use. “Units” refer to graduations on a standard measuring syringe.

Open the full calculator & guide

Related compounds

BPC-157
Buy 3 · −25%

Healing & Recovery

BPC-157

A synthetic pentadecapeptide supplied as lyophilized powder for laboratory and analytical research. For research use only.

from $41.00
per mg
IGF1-LR3
Buy 3 · −25%

Healing & Recovery

IGF1-LR3

A modified analog of Insulin-like Growth Factor-1 engineered for enhanced stability and extended activity in research settings. For research use only.

from $85.00
per mg
KPV
Buy 3 · −25%

Healing & Recovery

KPV

A tripeptide derived from alpha-MSH studied for its role in inflammatory signaling and cellular regulation. For research use only.

from $40.00
per mg
PEG-MGF
Buy 3 · −25%

Healing & Recovery

PEG-MGF

A pegylated variant of Mechano Growth Factor studied for its enhanced stability and extended activity in research settings. For research use only.

from $95.00
per mg