For Research Use Only · Discreet Worldwide Delivery · Crypto Payments · Free Shipping Starts at $210
R
Sign in Create account
All Products
Metabolic & Weight 14 Healing & Recovery 8 Growth Hormone 7 Cognitive & Mood 5 Longevity & Cellular 5 Immune Support 2 Hormonal & Vitality 5 Skin & Cosmetic 3 Lab Supplies 1
Best Sellers Quality & Testing Reconstitution Calculator Peptide Glossary Blog FAQ About Contact
Sign in Create account

Immune Support

LL-37

per mg

Buy 3, get 25% off on this product — discount applies automatically in your cart.

A cathelicidin-derived antimicrobial peptide studied for its role in innate immune function and cellular signaling. For research use only.

Tested

HPLC & MS

Discreet

Tracked ship

Crypto

BTC·ETH·USDT

Description

LL-37 is a cathelicidin-derived antimicrobial peptide studied for its role in innate immune function and cellular signaling. Research applications commonly focus on antimicrobial activity, immune response pathways, tissue repair mechanisms, and cell migration in experimental models.

For Research Use Only. Not for human consumption.

Highlights

  • Antimicrobial Activity Research
  • Innate Immune Function Studies
  • Tissue Repair Mechanism Research
  • Cell Migration Studies

Storage & handling

Storage: Store lyophilized at -20°C, protected from light. Stable at ambient temperature for short-term shipping.
Reconstitution (lab use): Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution.

Quality & Verification

Purity
≥99%
Tested by
HPLC, MS
Verification
Independent 3rd-party
Request batch COA

Certificate of Analysis available on request

How we test & certify →

Technical data sheet

CAS number
154947-66-7
Molecular formula
C205H340N60O53
Molecular weight
4493.33 g/mol
Synonyms
Cathelicidin antimicrobial peptide
Appearance
Lyophilized white powder
Molecular Formula
C₂₀₅H₃₄₀N₆₀O₅₃
Form
Lyophilized Powder
Purity
≥99%
Storage
-20°C
Research Use Only
Not for human consumption
CAT / SKU
RBL-LL37-5MG
Category
Immune Support

Sequence

[LL-37, 37 aa]

For laboratory and research use only. Not for human or veterinary use, diagnosis, or treatment.

Research FAQ

LL-37 — frequently asked questions

A cathelicidin-derived antimicrobial peptide studied for its role in innate immune function and cellular signaling. For research use only. In laboratory settings, research interest commonly focuses on areas such as antimicrobial activity research, innate immune function studies, tissue repair mechanism research and cell migration studies.
No. LL-37 is supplied exclusively as a research compound for in-vitro and non-human laboratory study. We do not provide health, dosing, or treatment guidance, and it must be handled by trained personnel following appropriate safety practices. All products are supplied strictly for laboratory and research use only and are not for human consumption.
Tested batches of LL-37 are independently analysed to a target purity of ≥99% by HPLC, MS. The exact figure for each batch is reported on its Certificate of Analysis.
LL-37 has a cas number of 154947-66-7, a molecular formula of c205h340n60o53 and a molecular weight of 4493.33 g/mol. Full technical details are listed in the technical data sheet on this page.
LL-37 should be stored as follows: Store lyophilized at -20°C, protected from light. Stable at ambient temperature for short-term shipping. Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution.
Yes. Tested batches of LL-37 are supplied with documentation of independent third-party purity and identity analysis, so researchers can verify exactly what they receive. The COA is available on this page or on request.
LL-37 is packaged discreetly and shipped worldwide with tracked delivery, typically dispatched within 24 hours of confirmed payment. Checkout is secure cryptocurrency only (BTC, ETH, LTC, USDT).
LL-37 is supplied as lyophilized white powder, sealed in a vial for laboratory research. Orders are packaged discreetly and shipped worldwide with tracking, typically dispatched within 24 hours of confirmed payment.
In the laboratory, LL-37 is reconstituted by dissolving the lyophilized powder in a suitable solvent such as bacteriostatic or sterile water. Reconstitute with bacteriostatic or sterile water for laboratory use. Refrigerate (2–8°C) after reconstitution. Our reconstitution calculator (under Research Tools) can help determine the concentration of the prepared solution. This is laboratory guidance only, not dosing advice.
Yes. LL-37 is also referred to as Cathelicidin antimicrobial peptide. These names all refer to the same research compound.
The amino-acid sequence of LL-37 is [LL-37, 37 aa] The full technical data sheet, including molecular formula and weight, is shown on this product page.
Research compounds such as LL-37 can generally be purchased for laboratory research, but legal status varies by country and by specific compound. Buyers are responsible for knowing and complying with the laws and import regulations in their own jurisdiction. It is supplied for research use only and is not for human consumption.
Yes. We can accommodate larger research orders of LL-37. Contact our research-support team to discuss bulk quantities, current availability and pricing.

Research tool

Reconstitution calculator

Estimate the concentration of LL-37 once reconstituted, and the volume containing a target quantity. A laboratory measurement aid — research use only.

Reconstitution calculator

Solution concentration mg/mL ( mcg/mL)
Volume for target mL ( units)

The target volume exceeds the solvent added — increase the solvent volume or lower the target quantity.

For laboratory measurement and research use only. This tool reports the concentration of a reconstituted solution; it is not dosing guidance and the products are not for human or veterinary use. “Units” refer to graduations on a standard measuring syringe.

Open the full calculator & guide

Continue researching

Category

All Immune Support compounds

Learn

Educational research blog

Reference

Full research FAQ & guides

Related compounds

Thymosin Alpha-1
Buy 3 · −25%

Immune Support

Thymosin Alpha-1

A synthetic peptide used in research to investigate immune system regulation. For research use only.

from $155.00
per mg